PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 389aa    MW: 44577.4 Da    PI: 6.5142
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087284.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.33e-211053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    r e+ s rqvt+ kRrngilKKA+E+SvLCd+++ +++fs+tgk
  XP_011087284.1 10 RLESLSSRQVTYGKRRNGILKKAQEISVLCDIDIILLMFSPTGK 53
                    678999************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.927161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-18323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-181255IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRVKLKIQR LESLSSRQVT YGKRRNGILK KAQEISVLCD IDIILLMFSP TGKPSIFRGQ  60
RSNIDEMIAK YAQLTPKERA KRRLESLETL KRNFKKVDQD VDIEEFLDAS SPSVEEMQNR  120
VMVLQSQLTE VHKRLSWWTN PDKIEDIEHL NQMENSLRES LNRMRLHKVS DGWLTECANS  180
WRNMKQQSYV GWNKLLNGLN SSFGLIPIIS FDCTSQSQNG MHFPIMASND PDCQTQTWHP  240
GGVREHMILP NEPHFLTSRD MECSRDMSFP SCSGFFGNVK NQDIDKAIPQ KNDRQDDGIT  300
IDDYAGSSFL RLPLAEQYPF HTFGNFSFPD MIEPGRDANF QPAPIDYQIN GNFELPRSVY  360
NSLVPPAASC AISIFNDNSY PQPPNQFNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S5e-15192190Myocyte-specific enhancer factor 2B
1tqe_R5e-15192190Myocyte-specific enhancer factor 2B
1tqe_Q5e-15192190Myocyte-specific enhancer factor 2B
1tqe_P5e-15192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087284.10.0PREDICTED: uncharacterized protein LOC105168825
TrEMBLA0A022R6G60.0A0A022R6G6_ERYGU; Uncharacterized protein
STRINGVIT_17s0000g06340.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76402124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.19e-76AGAMOUS-like 65